ID2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ID2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0996P
• Supplier Catalog Number: CNA0996P
• Alternative Catalog Number: MBL-CNA0996P
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2).
• Conjugation: Unconjugated
• Alternative Names: GIG8, ID2A, ID2H, bHLHb26

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 15kDa
• NCBI: 3398
• UniProt: Q02363
• Buffer: PBS with 0.05% proclin300,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.05% proclin300,50% glycerol
• Sequence: LQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
• Target: ID2

Application Notes

• Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200