GEN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10001S
Article Name: GEN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10001S
Supplier Catalog Number: CNA10001S
Alternative Catalog Number: MBL-CNA10001S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 669-908 of human GEN1 (NP_872431.3).
Conjugation: Unconjugated
Alternative Names: Gen
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 348654
UniProt: Q17RS7
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LQDLPLKERIFTKLSYPQDNLQPDVNLKTLSILSVKESCIANSGSDCTSHLSKDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRKVDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKLSSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQRLKLRFQST
Target: GEN1
Application Dilute: WB: WB,1:500 - 1:2000