GNG7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10009S
Article Name: GNG7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10009S
Supplier Catalog Number: CNA10009S
Alternative Catalog Number: MBL-CNA10009S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human GNG7 (NP_443079.1).
Conjugation: Unconjugated
Alternative Names: HG3B
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 2788
UniProt: O60262
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Target: GNG7
Application Dilute: WB: WB,1:500 - 1:1000