UGT1A6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10033S
Article Name: UGT1A6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10033S
Supplier Catalog Number: CNA10033S
Alternative Catalog Number: MBL-CNA10033S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 65-270 of human UGT1A6 (NP_001063.2).
Conjugation: Unconjugated
Alternative Names: GNT1, UGT1, HLUGP, UDPGT, UGT1A, UGT1C, UGT1E, UGT1F, HLUGP1, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A1, UGT1A3, UGT1A5, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1A6S, hUG-BR1, UDPGT 1-6
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 54578
UniProt: P19224
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPN
Target: UGT1A6
Application Dilute: WB: WB,1:500 - 1:1000