SUCLA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10040S
Article Name: SUCLA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10040S
Supplier Catalog Number: CNA10040S
Alternative Catalog Number: MBL-CNA10040S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SUCLA2 (NP_003841.1).
Conjugation: Unconjugated
Alternative Names: A-SCS, A-BETA, MTDPS5, LINC00444, SCS-betaA
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 8803
UniProt: Q9P2R7
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGP
Target: SUCLA2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200