IL17RA Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10052S
| Article Name: |
IL17RA Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10052S |
| Supplier Catalog Number: |
CNA10052S |
| Alternative Catalog Number: |
MBL-CNA10052S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 697-866 of human IL17RA (NP_055154.3). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CD217, IL17R, IMD51, CANDF5, CDw217, IL-17RA, hIL-17R |
| Clonality: |
Polyclonal |
| Molecular Weight: |
96kDa |
| NCBI: |
23765 |
| UniProt: |
Q96F46 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
AGEGEACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA |
| Target: |
IL17RA |
| Application Dilute: |
WB: WB,1:1000 - 1:4000 |
