DDR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10060S
Article Name: DDR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10060S
Supplier Catalog Number: CNA10060S
Alternative Catalog Number: MBL-CNA10060S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human DDR2 (NP_001014796.1).
Conjugation: Unconjugated
Alternative Names: TKT, WRCN, MIG20a, NTRKR3, TYRO10
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 4921
UniProt: Q16832
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRI
Target: DDR2
Application Dilute: WB: WB,1:500 - 1:2000