KIR3DL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10064S
Article Name: KIR3DL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10064S
Supplier Catalog Number: CNA10064S
Alternative Catalog Number: MBL-CNA10064S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-322 of human KIR3DL3 (NP_703144.3).
Conjugation: Unconjugated
Alternative Names: KIR44, KIRC1, CD158Z, KIR3DL7, KIR2DL5B
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 115653
UniProt: Q8N743
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQAN
Target: KIR3DL3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200