SCN1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10071S
Article Name: SCN1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10071S
Supplier Catalog Number: CNA10071S
Alternative Catalog Number: MBL-CNA10071S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1).
Conjugation: Unconjugated
Alternative Names: DEE52, ATFB13, BRGDA5, EIEE52, GEFSP1
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 6324
UniProt: Q07699
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKGESGAACPFTV
Target: SCN1B
Application Dilute: WB: WB,1:500 - 1:2000