PCDH15 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10086S
Article Name: PCDH15 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10086S
Supplier Catalog Number: CNA10086S
Alternative Catalog Number: MBL-CNA10086S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-400 of human PCDH15 (NP_001136235.1).
Conjugation: Unconjugated
Alternative Names: USH1F, CDHR15, DFNB23
Clonality: Polyclonal
Molecular Weight: 216kDa
NCBI: 65217
UniProt: Q96QU1
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TVNELTPVGTTIFTGFSGDNGATDIDDGPNGQIEYVIQYNPDDPTSNDTFEIPLMLTGNIVLRKRLNYEDKTRYFVIIQANDRAQNLNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPIIVTPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELSLLEPVNRDFHQKFDLVIKAEQDNGHPLPAFAGLHIEILDENNQSPYF
Target: PCDH15
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200