TRPC5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10089P
Article Name: TRPC5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10089P
Supplier Catalog Number: CNA10089P
Alternative Catalog Number: MBL-CNA10089P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human TRPC5 (NP_036603.1).
Conjugation: Unconjugated
Alternative Names: TRP5, PPP1R159
Clonality: Polyclonal
Molecular Weight: 111kDa
NCBI: 7224
UniProt: Q9UL62
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: NLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
Target: TRPC5
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200