IL36R Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10090S
Article Name: IL36R Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10090S
Supplier Catalog Number: CNA10090S
Alternative Catalog Number: MBL-CNA10090S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human IL36R (NP_003845.2).
Conjugation: Unconjugated
Alternative Names: IL-36R, IL1RRP2, IL-1Rrp2, IL1R-rp2
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 8808
UniProt: Q9HB29
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKH
Target: IL1RL2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200