ATP4B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10106S
Article Name: ATP4B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10106S
Supplier Catalog Number: CNA10106S
Alternative Catalog Number: MBL-CNA10106S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 62-291 of human ATP4B (NP_000696.1).
Conjugation: Unconjugated
Alternative Names: ATP6B
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 496
UniProt: P51164
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Target: ATP4B
Application Dilute: WB: WB,1:500 - 1:2000