alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1011P
Article Name: alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1011P
Supplier Catalog Number: CNA1011P
Alternative Catalog Number: MBL-CNA1011P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human alpha-Smooth Muscle Actin (ACTA2) (NP_001135417.1).
Conjugation: Unconjugated
Alternative Names: ACTSA
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 59
UniProt: P62736
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Target: ACTA2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200