ZP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10126S
Article Name: ZP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10126S
Supplier Catalog Number: CNA10126S
Alternative Catalog Number: MBL-CNA10126S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1).
Conjugation: Unconjugated
Alternative Names: ZPA, Zp-2, OOMD6, OZEMA6
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 7783
UniProt: Q05996
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH
Target: ZP2
Application Dilute: WB: WB,1:1000 - 1:4000|IF/ICC,1:50 - 1:200