AP1M1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10129P
| Article Name: |
AP1M1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10129P |
| Supplier Catalog Number: |
CNA10129P |
| Alternative Catalog Number: |
MBL-CNA10129P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human AP1M1 (NP_115882.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
AP47, mu1A, CLTNM, MU-1A, CLAPM2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
49kDa |
| NCBI: |
8907 |
| UniProt: |
Q9BXS5 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWR |
| Target: |
AP1M1 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
