RPS6KA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10130P
Article Name: RPS6KA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10130P
Supplier Catalog Number: CNA10130P
Alternative Catalog Number: MBL-CNA10130P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 673-772 of human RPS6KA4 (NP_003933.1).
Conjugation: Unconjugated
Alternative Names: MSK2, RSK-B, S6K-alpha-4
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 8986
UniProt: O75676
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: WLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
Target: RPS6KA4
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:20 - 1:100