TXNL4A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10138S
Article Name: TXNL4A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10138S
Supplier Catalog Number: CNA10138S
Alternative Catalog Number: MBL-CNA10138S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human TXNL4A (NP_006692.1).
Conjugation: Unconjugated
Alternative Names: BMKS, DIB1, DIM1, TXNL4, SNRNP15, U5-15kD
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 10907
UniProt: P83876
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
Target: TXNL4A
Application Dilute: WB: WB,1:500 - 1:2000