KLHL9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10149S
Article Name: KLHL9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10149S
Supplier Catalog Number: CNA10149S
Alternative Catalog Number: MBL-CNA10149S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KLHL9 (NP_061335.1).
Conjugation: Unconjugated
Alternative Names: KLHL9
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 55958
UniProt: Q9P2J3
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNK
Target: KLHL9
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200