CRLF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10152S
Article Name: CRLF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10152S
Supplier Catalog Number: CNA10152S
Alternative Catalog Number: MBL-CNA10152S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-231 of human CRLF2 (NP_071431.2).
Conjugation: Unconjugated
Alternative Names: CRL2, TSLPR, CRLF2Y
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 64109
UniProt: Q9HC73
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: QGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Target: CRLF2
Application Dilute: WB: WB,1:200 - 1:1000