GRHL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10153S
Article Name: GRHL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10153S
Supplier Catalog Number: CNA10153S
Alternative Catalog Number: MBL-CNA10153S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human GRHL2 (NP_079191.2).
Conjugation: Unconjugated
Alternative Names: BOM, ECTDS, PPCD4, DFNA28, TFCP2L3
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 79977
UniProt: Q6ISB3
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQY
Target: GRHL2
Application Dilute: WB: WB,1:500 - 1:1000