Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Alpha-1 Antitrypsin (SERPINA1) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA1015S
• Supplier Catalog Number: CNA1015S
• Alternative Catalog Number: MBL-CNA1015S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-315 of human Alpha-1 Antitrypsin (Alpha-1 Antitrypsin (SERPINA1)) (NP_000286.3).
• Conjugation: Unconjugated
• Alternative Names: PI, A1A, AAT, PI1, A1AT, nNIF, PRO2275, alpha1AT

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 5265
• UniProt: P01009
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFL
• Target: SERPINA1

Application Notes

• Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200