SMUG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10166S
Article Name: SMUG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10166S
Supplier Catalog Number: CNA10166S
Alternative Catalog Number: MBL-CNA10166S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human SMUG1 (NP_055126.1).
Conjugation: Unconjugated
Alternative Names: FDG, UNG3, HMUDG
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 23583
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAV
Target: SMUG1
Application Dilute: WB: WB,1:200 - 1:1000