PDX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10173S
Article Name: PDX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10173S
Supplier Catalog Number: CNA10173S
Alternative Catalog Number: MBL-CNA10173S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDX1 (NP_000200.1).
Conjugation: Unconjugated
Alternative Names: GSF, IPF1, IUF1, IDX-1, MODY4, PDX-1, STF-1, PAGEN1
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 3651
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPF
Target: PDX1
Application Dilute: WB: WB,1:500 - 1:1000