TPMT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1017S
Article Name: TPMT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1017S
Supplier Catalog Number: CNA1017S
Alternative Catalog Number: MBL-CNA1017S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human TPMT (NP_000358.1).
Conjugation: Unconjugated
Alternative Names: TPMTD
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 7172
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK
Target: TPMT
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100