IARS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10190S
Article Name: IARS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10190S
Supplier Catalog Number: CNA10190S
Alternative Catalog Number: MBL-CNA10190S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human IARS (NP_002152.2).
Conjugation: Unconjugated
Alternative Names: IRS, IARS, ILRS, ILERS, GRIDHH, PRO0785
Clonality: Polyclonal
Molecular Weight: 144kDa
NCBI: 3376
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
Target: IARS1
Application Dilute: WB: WB,1:500 - 1:2000