KIF4A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10193S
Article Name: KIF4A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10193S
Supplier Catalog Number: CNA10193S
Alternative Catalog Number: MBL-CNA10193S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 870-1080 of human KIF4A (NP_036442.3).
Conjugation: Unconjugated
Alternative Names: KIF4, KIF4G1, MRX100, XLID100
Clonality: Polyclonal
Molecular Weight: 140kDa
NCBI: 24137
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LIGELVSSKIQVSKLESSLKQSKTSCADMQKMLFEERNHFAEIETELQAELVRMEQQHQEKVLYLLSQLQQSQMAEKQLEESVSEKEQQLLSTLKCQDEELEKMREVCEQNQQLLRENEIIKQKLTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKLVKVSR
Target: KIF4A
Application Dilute: WB: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:200