ZSCAN4C Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10205S
Article Name: |
ZSCAN4C Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA10205S |
Supplier Catalog Number: |
CNA10205S |
Alternative Catalog Number: |
MBL-CNA10205S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 400-506 of mouse ZSCAN4 (NP_001013787.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
Gm397, Zscan4d, XM_142517 |
Clonality: |
Polyclonal |
Molecular Weight: |
57kDa |
NCBI: |
245109 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD |
Target: |
Zscan4c |
Application Dilute: |
WB: WB,1:500 - 1:2000 |