CLDN5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10207P
Article Name: CLDN5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10207P
Supplier Catalog Number: CNA10207P
Alternative Catalog Number: MBL-CNA10207P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 119-218 of human CLDN5 (NP_001349995.1).
Conjugation: Unconjugated
Alternative Names: AWAL, BEC1, TMVCF, TMDVCF, CPETRL1
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 7122
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Target: CLDN5
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200