DIAPH2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10209S
Article Name: DIAPH2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10209S
Supplier Catalog Number: CNA10209S
Alternative Catalog Number: MBL-CNA10209S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DIAPH2 (NP_009293.1).
Conjugation: Unconjugated
Alternative Names: DIA, POF, DIA2, DRF2, POF2, POF2A
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 1730
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
Target: DIAPH2
Application Dilute: WB: WB,1:1000 - 1:2000