Aurora B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1020T
Article Name: Aurora B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1020T
Supplier Catalog Number: CNA1020T
Alternative Catalog Number: MBL-CNA1020T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2).
Conjugation: Unconjugated
Alternative Names: AIK2, AIM1, ARK2, AurB, IPL1, STK5, AIM-1, ARK-2, STK-1, STK12, PPP1R48, aurkb-sv1, aurkb-sv2
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 9212
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
Target: AURKB
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200