GPER1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10217T
Article Name: GPER1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10217T
Supplier Catalog Number: CNA10217T
Alternative Catalog Number: MBL-CNA10217T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 307-375 of human GPER1 (Q99527).
Conjugation: Unconjugated
Alternative Names: mER, CEPR, GPER, DRY12, FEG-1, GPR30, LERGU, LyGPR, CMKRL2, LERGU2, GPCR-Br
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 2852
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
Target: GPER1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200