H3F3B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10220S
| Article Name: |
H3F3B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10220S |
| Supplier Catalog Number: |
CNA10220S |
| Alternative Catalog Number: |
MBL-CNA10220S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human H3F3B (NP_002098.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
H3-3A, H3.3B, H3F3B, BRYLIB2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
15kDa |
| NCBI: |
3021 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Target: |
H3-3B |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
