DMT1/SLC11A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10231P
Article Name: DMT1/SLC11A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10231P
Supplier Catalog Number: CNA10231P
Alternative Catalog Number: MBL-CNA10231P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human DMT1/SLC11A2 (NP_001167597.1).
Conjugation: Unconjugated
Alternative Names: DCT1, DMT1, AHMIO1, NRAMP2
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 4891
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
Target: SLC11A2
Application Dilute: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200