Septin 4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10238S
Article Name: Septin 4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10238S
Supplier Catalog Number: CNA10238S
Alternative Catalog Number: MBL-CNA10238S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Septin 4 (NP_536341.1).
Conjugation: Unconjugated
Alternative Names: H5, ARTS, MART, SEP4, CE5B3, SEPT4, PNUTL2, hucep-7, BRADEION, C17orf47, hCDCREL-2
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 5414
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSE
Target: SEPTIN4
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200