SLC25A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10247S
Article Name: SLC25A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10247S
Supplier Catalog Number: CNA10247S
Alternative Catalog Number: MBL-CNA10247S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-311 of human SLC25A1 (NP_005975.1).
Conjugation: Unconjugated
Alternative Names: CIC, CTP, SEA, CMS23, D2L2AD, SLC20A3
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 6576
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAH
Target: SLC25A1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200