Cytokeratin 8 (KRT8) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1024P
Article Name: Cytokeratin 8 (KRT8) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1024P
Supplier Catalog Number: CNA1024P
Alternative Catalog Number: MBL-CNA1024P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-483 of human Cytokeratin 8 (KRT8) (NP_002264.1).
Conjugation: Unconjugated
Alternative Names: K8, KO, CK8, CK-8, CYK8, K2C8, CARD2
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 3856
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL
Target: KRT8
Application Dilute: WB: WB,1:2000 - 1:4000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200