TPD52 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA10254S
| Article Name: |
TPD52 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA10254S |
| Supplier Catalog Number: |
CNA10254S |
| Alternative Catalog Number: |
MBL-CNA10254S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TPD52 (NP_005070.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
D52, N8L, PC-1, PrLZ, hD52 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
24kDa |
| NCBI: |
7163 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Target: |
TPD52 |
| Application Dilute: |
WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200 |
