XPNPEP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10255S
Article Name: XPNPEP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10255S
Supplier Catalog Number: CNA10255S
Alternative Catalog Number: MBL-CNA10255S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-240 of human XPNPEP2 (NP_003390.4).
Conjugation: Unconjugated
Alternative Names: APP2, AEACEI
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 7512
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
Target: XPNPEP2
Application Dilute: WB: WB,1:1000 - 1:2000