eIF3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10259S
Article Name: eIF3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10259S
Supplier Catalog Number: CNA10259S
Alternative Catalog Number: MBL-CNA10259S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human eIF3B (NP_003742.2).
Conjugation: Unconjugated
Alternative Names: PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 8662
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEPRALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA
Target: EIF3B
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200