EIF2B3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10262S
Article Name: EIF2B3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10262S
Supplier Catalog Number: CNA10262S
Alternative Catalog Number: MBL-CNA10262S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EIF2B3 (NP_065098.1).
Conjugation: Unconjugated
Alternative Names: EIF-2B, EIF2Bgamma
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 8891
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDLFRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLK
Target: EIF2B3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200