14-3-3 sigma Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1026T
Article Name: 14-3-3 sigma Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1026T
Supplier Catalog Number: CNA1026T
Alternative Catalog Number: MBL-CNA1026T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (NP_006133.1).
Conjugation: Unconjugated
Alternative Names: YWHAS
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 2810
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
Target: SFN
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200