POMT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10281S
Article Name: POMT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10281S
Supplier Catalog Number: CNA10281S
Alternative Catalog Number: MBL-CNA10281S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 310-550 of human POMT1 (NP_001070833.1).
Conjugation: Unconjugated
Alternative Names: RT, LGMD2K, MDDGA1, MDDGB1, MDDGC1, LGMDR11
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 10585
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: VFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEW
Target: POMT1
Application Dilute: WB: WB,1:1000 - 1:2000