DUSP14 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10287S
Article Name: DUSP14 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10287S
Supplier Catalog Number: CNA10287S
Alternative Catalog Number: MBL-CNA10287S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DUSP14 (NP_008957.1).
Conjugation: Unconjugated
Alternative Names: MKP6, MKP-L
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 11072
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Target: DUSP14
Application Dilute: WB: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200