EMC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10290S
Article Name: EMC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10290S
Supplier Catalog Number: CNA10290S
Alternative Catalog Number: MBL-CNA10290S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 885-965 of human EMC1 (NP_055862.1).
Conjugation: Unconjugated
Alternative Names: CAVIPMR, KIAA0090
Clonality: Polyclonal
Molecular Weight: 112kDa
NCBI: 23065
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLI
Target: EMC1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200