ICMT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10293S
Article Name: ICMT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10293S
Supplier Catalog Number: CNA10293S
Alternative Catalog Number: MBL-CNA10293S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 175-284 of human ICMT (NP_036537.1).
Conjugation: Unconjugated
Alternative Names: PCMT, PPMT, PCCMT, HSTE14, MST098, MSTP098
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 23463
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: KAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Target: ICMT
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200