SNAPIN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10294S
Article Name: SNAPIN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10294S
Supplier Catalog Number: CNA10294S
Alternative Catalog Number: MBL-CNA10294S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human SNAPIN (NP_036569.1).
Conjugation: Unconjugated
Alternative Names: BLOS7, BORCS3, SNAPAP, BLOC1S7
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 23557
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Target: SNAPIN
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:200