INVS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10298S
Article Name: INVS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10298S
Supplier Catalog Number: CNA10298S
Alternative Catalog Number: MBL-CNA10298S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human INVS (NP_055240.2).
Conjugation: Unconjugated
Alternative Names: INV, NPH2, NPHP2
Clonality: Polyclonal
Molecular Weight: 118kDa
NCBI: 27130
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQ
Target: INVS
Application Dilute: WB: WB,1:500 - 1:2000