CISD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA10317S
Article Name: CISD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA10317S
Supplier Catalog Number: CNA10317S
Alternative Catalog Number: MBL-CNA10317S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1).
Conjugation: Unconjugated
Alternative Names: ZCD1, MDS029, C10orf70, mitoNEET
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 55847
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Target: CISD1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200