[KO Validated] DFFA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1032S
Article Name: [KO Validated] DFFA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1032S
Supplier Catalog Number: CNA1032S
Alternative Catalog Number: MBL-CNA1032S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human DFFA (NP_004392.1).
Conjugation: Unconjugated
Alternative Names: DFF1, ICAD, DFF-45
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 1676
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELS
Target: DFFA
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100